Class b: All beta proteins [48724] (141 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (4 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (24 proteins) |
Protein GTPase-binding domain of the cell polarity protein par6 (Par-6B) [89315] (2 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [101716] (2 PDB entries) Cg5884-pa |
Domain d1ry4a_: 1ry4 A: [98085] |
PDB Entry: 1ry4 (more details)
SCOP Domain Sequences for d1ry4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ry4a_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster)} gsktkapsisiphdfrqvsaiidvdivpethrrvrllkhgsdkplgfyirdgtsvrvtas glekqpgifisrlvpgglaestgllavndevievngievagktldqvtdmmvanssnlii tvkpanqr
Timeline for d1ry4a_: