| Class a: All alpha proteins [46456] (286 folds) |
| Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
| Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins) |
| Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species) |
| Species Escherichia coli [TaxId:562] [101453] (2 PDB entries) |
| Domain d1rqia_: 1rqi A: [97742] complexed with dpo, dst, ipr, mg |
PDB Entry: 1rqi (more details), 2.42 Å
SCOPe Domain Sequences for d1rqia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqia_ a.128.1.1 (A:) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]}
amdfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmf
gvstntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqt
lafsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihr
hktgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrq
gadqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk
Timeline for d1rqia_: