SCOPe 2.06: Domain d1rqia1: 1rqi A:22-320

Lineage for d1rqia1 (1rqi A:22-320)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)

7. Species Escherichia coli [TaxId:562] [101453] (2 PDB entries)

8. Domain d1rqia1: 1rqi A:22-320 [97742]
   Other proteins in same PDB: d1rqia2
   complexed with dpo, dst, ipr, mg

Details for d1rqia1

PDB Entry: 1rqi, 2.42 Å

PDB Description: active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and dimethylallyl s-thiolodiphosphate

PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d1rqia1:

Sequence; same for both SEQRES and ATOM records:

>d1rqia1 a.128.1.1 (A:22-320) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]}
mdfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfg
vstntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtl
afsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrh
ktgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqg
adqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk

Timeline for d1rqia1:

• d1rqia1 first appeared in SCOP 1.67, called d1rqia_
  
• d1rqia1 was called d1rqia_ in SCOPe 2.05
  
• d1rqia1 appears in SCOPe 2.07
  
• d1rqia1 appears in the current release, SCOPe 2.08