Lineage for d1rqia1 (1rqi A:22-320)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014347Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2014348Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2014349Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)
  6. 2014350Protein Farnesyl diphosphate synthase (geranyltranstransferase) [48578] (3 species)
  7. 2014357Species Escherichia coli [TaxId:562] [101453] (2 PDB entries)
  8. 2014360Domain d1rqia1: 1rqi A:22-320 [97742]
    Other proteins in same PDB: d1rqia2
    complexed with dpo, dst, ipr, mg

Details for d1rqia1

PDB Entry: 1rqi (more details), 2.42 Å

PDB Description: active conformation of farnesyl pyrophosphate synthase bound to isopentyl pyrophosphate and dimethylallyl s-thiolodiphosphate
PDB Compounds: (A:) Geranyltranstransferase

SCOPe Domain Sequences for d1rqia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqia1 a.128.1.1 (A:22-320) Farnesyl diphosphate synthase (geranyltranstransferase) {Escherichia coli [TaxId: 562]}
mdfpqqleacvkqanqalsrfiaplpfqntpvvetmqygallggkrlrpflvyatghmfg
vstntldapaaavecihayslihddlpamddddlrrglptchvkfgeanailagdalqtl
afsilsdadmpevsdrdrismiselasasgiagmcggqaldldaegkhvpldalerihrh
ktgaliraavrlgalsagdkgrralpvldkyaesiglafqvqddildvvgdtatlgkrqg
adqqlgkstypallgleqarkkardliddarqslkqlaeqsldtsalealadyiiqrnk

SCOPe Domain Coordinates for d1rqia1:

Click to download the PDB-style file with coordinates for d1rqia1.
(The format of our PDB-style files is described here.)

Timeline for d1rqia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rqia2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rqib_