Lineage for d1rl3a2 (1rl3 A:245-376)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
one turn of helix is made by two pairs of antiparallel strands linked with short turns
has appearance of a sandwich of distinct architecture and jelly-roll topology
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) 
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
Pfam PF00027
Protein Regulatory subunit of Protein kinase A [51213] (2 species)
duplication: consists of two similar domains
Species Cow (Bos taurus) [TaxId:9913] [51214] (5 PDB entries)
Uniprot P00514 109-376
Domain d1rl3a2: 1rl3 A:245-376 [104976]
complexed with gol, pcg
Details for d1rl3a2
PDB Entry: 1rl3 (more details), 2.7 Å
PDB Description: Crystal structure of cAMP-free R1a subunit of PKA
PDB Compounds: (A:) cAMP-dependent protein kinase type I-alpha regulatory chainSCOPe Domain Sequences for d1rl3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rl3a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]}
eeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiilegsaavlqrr
seneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkldrprfervlgpcsdil
krniqqynsfvs
SCOPe Domain Coordinates for d1rl3a2:
Click to download the PDB-style file with coordinates for d1rl3a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rl3a2:
- d1rl3a2 first appeared in SCOP 1.69
- d1rl3a2 appears in SCOPe 2.06
- d1rl3a2 appears in the current release, SCOPe 2.08
View in 3D
