SCOP 1.69: Domain d1rl3a2: 1rl3 A:245-376

Lineage for d1rl3a2 (1rl3 A:245-376)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (3 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (6 proteins)
   Pfam 00027

6. Protein Regulatory subunit of Protein kinase A [51213] (2 species)
   duplication: consists of two similar domains

7. Species Cow (Bos taurus) [TaxId:9913] [51214] (4 PDB entries)

8. Domain d1rl3a2: 1rl3 A:245-376 [104976]

Details for d1rl3a2

PDB Entry: 1rl3, 2.7 Å

PDB Description: Crystal structure of cAMP-free R1a subunit of PKA

SCOP Domain Sequences for d1rl3a2:

Sequence; same for both SEQRES and ATOM records:

>d1rl3a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus)}
eeflskvsilesldkwerltvadalepvqfedgqkivvqgepgdeffiilegsaavlqrr
seneefvevgrlgpsdyfgeiallmnrpraatvvargplkcvkldrprfervlgpcsdil
krniqqynsfvs

Timeline for d1rl3a2:

• d1rl3a2 is new in SCOP 1.69
  
• d1rl3a2 appears in SCOP 1.71
  
• d1rl3a2 appears in the current release, SCOPe 2.08