Lineage for d1re0b_ (1re0 B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.3: Sec7 domain [48425] (2 families) 
Family a.118.3.1: Sec7 domain [48426] (6 proteins)
Pfam PF01369
Protein ARF guanine-exchange factor 1 [101413] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [101414] (1 PDB entry) 
Domain d1re0b_: 1re0 B: [97318]
Other proteins in same PDB: d1re0a_
complexed with ARF1
complexed with afb, cit, gdp, mg
Details for d1re0b_
PDB Entry: 1re0 (more details), 2.4 Å
PDB Description: Structure of ARF1-GDP bound to Sec7 domain complexed with Brefeldin A
PDB Compounds: (B:) ARF guanine-nucleotide exchange factor 1SCOPe Domain Sequences for d1re0b_:
Sequence, based on SEQRES records: (download)
>d1re0b_ a.118.3.1 (B:) ARF guanine-exchange factor 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gshmasdrktefilcvetfnekakkgiqmliekgfidsdsnrdiasflflnngrlnkkti
glllcdpkktsllkefidlfdfkglrvdeairilltkfrlpgesqqieriveafsskysa
dqsndkveledkkagkngsesmteddiihvqpdadsvfvlsysiimlntdshnpqvkdhm
tfddysnnlrgcyngkdfprwylhkiytsikvkeivmpeeh
Sequence, based on observed residues (ATOM records): (download)
>d1re0b_ a.118.3.1 (B:) ARF guanine-exchange factor 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gshmasdrktefilcvetfnekakkgiqmliekgfidsdsnrdiasflflnngrlnkkti
glllcdpkktsllkefidlfdfkglrvdeairilltkfrlpgesqqieriveafsskysa
dqsvqpdadsvfvlsysiimlntdshnpqvkdhmtfddysnnlrgcyngkdfprwylhki
ytsikvkeivmpeeh
SCOPe Domain Coordinates for d1re0b_:
Click to download the PDB-style file with coordinates for d1re0b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1re0b_:
- d1re0b_ first appeared in SCOP 1.67
- d1re0b_ appears in SCOPe 2.04
- d1re0b_ is called d1re0b1 in SCOPe 2.06
- d1re0b_ appears in the current release, SCOPe 2.08, called d1re0b1
View in 3D
