Lineage for d1re0a_ (1re0 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1845935Protein ADP-ribosylation factor [52614] (16 species)
  7. 1845945Species Human (Homo sapiens), ARF1 [TaxId:9606] [52615] (12 PDB entries)
    Uniprot P32889
  8. 1845964Domain d1re0a_: 1re0 A: [97317]
    Other proteins in same PDB: d1re0b_
    complexed with a sec7 domain
    complexed with afb, cit, gdp, mg

Details for d1re0a_

PDB Entry: 1re0 (more details), 2.4 Å

PDB Description: Structure of ARF1-GDP bound to Sec7 domain complexed with Brefeldin A
PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d1re0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1re0a_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}
mrilmvgldaagkttilyklklgeivttiptigfnvetveyknisftvwdvggqdkirpl
wrhyfqntqglifvvdsndrervneareelmrmlaedelrdavllvfankqdlpnamnaa
eitdklglhslrhrnwyiqatcatsgdglyegldwlsnqlrn

SCOPe Domain Coordinates for d1re0a_:

Click to download the PDB-style file with coordinates for d1re0a_.
(The format of our PDB-style files is described here.)

Timeline for d1re0a_: