Lineage for d1rc2a_ (1rc2 A:)
- Root: SCOPe 2.01
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) 
Fold f.19: Aquaporin-like [81339] (1 superfamily)
core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helicesSuperfamily f.19.1: Aquaporin-like [81338] (2 families) 
Family f.19.1.1: Aquaporin-like [56895] (5 proteins)
duplication: consist of two similar structural partsProtein Aquaporin Z [103470] (1 species) Species Escherichia coli [TaxId:562] [103471] (6 PDB entries) 
Domain d1rc2a_: 1rc2 A: [97281]
complexed with bgl
Details for d1rc2a_
PDB Entry: 1rc2 (more details), 2.5 Å
PDB Description: 2.5 angstrom resolution x-ray structure of aquaporin z
PDB Compounds: (A:) Aquaporin ZSCOPe Domain Sequences for d1rc2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rc2a_ f.19.1.1 (A:) Aquaporin Z {Escherichia coli [TaxId: 562]}
mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg
hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng
ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv
tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtllekrd
SCOPe Domain Coordinates for d1rc2a_:
Click to download the PDB-style file with coordinates for d1rc2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rc2a_:
- d1rc2a_ first appeared in SCOP 1.67
- d1rc2a_ appears in SCOP 1.75
- d1rc2a_ appears in SCOPe 2.02
- d1rc2a_ appears in the current release, SCOPe 2.08
View in 3D
