Lineage for d1r0va3 (1r0v A:140-214)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958349Fold d.75: MutS N-terminal domain-like [55266] (2 superfamilies)
    beta(2)-alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2958350Superfamily d.75.1: tRNA-intron endonuclease N-terminal domain-like [55267] (1 family) (S)
  5. 2958351Family d.75.1.1: tRNA-intron endonuclease N-terminal domain-like [55268] (2 proteins)
  6. 2958352Protein Dimeric tRNA splicing endonuclease, domains 1 and 3 [103073] (1 species)
    duplication: one subunit consists of two tetrameric tRNA splicing endonuclease subunit-like repeats
  7. 2958353Species Archaeoglobus fulgidus [TaxId:2234] [103074] (4 PDB entries)
  8. 2958354Domain d1r0va3: 1r0v A:140-214 [96744]
    Other proteins in same PDB: d1r0va1, d1r0va2, d1r0vb1, d1r0vb2, d1r0vc1, d1r0vc2, d1r0vd1, d1r0vd2

Details for d1r0va3

PDB Entry: 1r0v (more details), 2 Å

PDB Description: Structure Determination of the Dimeric Endonuclease in a Pseudo-face-centerd P21212 space group
PDB Compounds: (A:) tRNA-intron endonuclease

SCOPe Domain Sequences for d1r0va3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0va3 d.75.1.1 (A:140-214) Dimeric tRNA splicing endonuclease, domains 1 and 3 {Archaeoglobus fulgidus [TaxId: 2234]}
geqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtlslieslylldlgklnlln
adreelvkrarever

SCOPe Domain Coordinates for d1r0va3:

Click to download the PDB-style file with coordinates for d1r0va3.
(The format of our PDB-style files is described here.)

Timeline for d1r0va3: