PDB entry 1r0v

View 1r0v on RCSB PDB site
Description: Structure Determination of the Dimeric Endonuclease in a Pseudo-face-centerd P21212 space group
Class: translation, hydrolase
Keywords: RNA splicing; endonuclease; x-ray crystallography, TRANSLATION, HYDROLASE
Deposited on 2003-09-23, released 2004-03-09
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.174
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA-intron endonuclease
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: EndA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29362 (Start-304)
      • conflict (151)
    Domains in SCOPe 2.08: d1r0va1, d1r0va2, d1r0va3
  • Chain 'B':
    Compound: tRNA-intron endonuclease
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: EndA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29362 (Start-304)
      • conflict (151)
    Domains in SCOPe 2.08: d1r0vb1, d1r0vb2, d1r0vb3
  • Chain 'C':
    Compound: tRNA-intron endonuclease
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: EndA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29362 (Start-304)
      • conflict (151)
    Domains in SCOPe 2.08: d1r0vc1, d1r0vc2, d1r0vc3
  • Chain 'D':
    Compound: tRNA-intron endonuclease
    Species: ARCHAEOGLOBUS FULGIDUS [TaxId:224325]
    Gene: EndA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29362 (Start-304)
      • conflict (151)
    Domains in SCOPe 2.08: d1r0vd1, d1r0vd2, d1r0vd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r0vA (A:)
    miggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
    edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
    vvdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvt
    lslieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfg
    sefrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcf
    ervkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0vA (A:)
    dfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrlav
    vdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtl
    slieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfgs
    efrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcfe
    rvkv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r0vB (B:)
    miggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
    edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
    vvdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvt
    lslieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfg
    sefrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcf
    ervkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0vB (B:)
    dfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrlav
    vdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtl
    slieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfgs
    efrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcfe
    rvkv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1r0vC (C:)
    miggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
    edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
    vvdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvt
    lslieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfg
    sefrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcf
    ervkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0vC (C:)
    dfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrlav
    vdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtl
    slieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfgs
    efrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcfe
    rvkv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1r0vD (D:)
    miggdfavvkakkslerrgfgvkrgdkiylhplevvylqikgiesfgeledvlswaesrm
    edfstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrla
    vvdeeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvt
    lslieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfg
    sefrvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcf
    ervkv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r0vD (D:)
    fstyyfvyedlrdrgnkvkiqgeflltkkpylpiserktirmeeiaekarnfdelrlavv
    deeseityfrvyepdmmgeqkeelpeiagvlsdeyvitkqteifsryfygsekgdlvtls
    lieslylldlgklnllnadreelvkrarevernfdrryevyrnlkergfvvktgfkfgse
    frvyrkvesvddlphseylvdiadsreirlidlaravrlaqnvrkrmvfaygknylcfer
    vkv