![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
![]() | Protein V8 protease [101809] (1 species) glutamic acid-specific protease |
![]() | Species Staphylococcus aureus [TaxId:1280] [101810] (3 PDB entries) Uniprot P04188 69-284 |
![]() | Domain d1qy6a_: 1qy6 A: [96574] complexed with k |
PDB Entry: 1qy6 (more details), 1.9 Å
SCOPe Domain Sequences for d1qy6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qy6a_ b.47.1.1 (A:) V8 protease {Staphylococcus aureus [TaxId: 1280]} vilpnndrhqitdttnghyapvtyiqveaptgtfiasgvvvgkdtlltnkhvvdathgdp halkafpsainqdnypnggftaeqitkysgegdlaivkfspneqnkhigevvkpatmsnn aetqtnqnitvtgypgdkpvatmweskgkitylkgeamqydlsttggnsgspvfneknev igihwggvpnefngavfinenvrnflkqniedinfa
Timeline for d1qy6a_: