PDB entry 1qy6

View 1qy6 on RCSB PDB site
Description: Structue of V8 Protease from Staphylococcus aureus
Class: Protease
Keywords: serine protease
Deposited on 2003-09-09, released 2004-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine protease
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99V45 (0-End)
      • conflict (124)
      • conflict (213)
    Domains in SCOPe 2.08: d1qy6a_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qy6A (A:)
    vilpnndrhqitdttnghyapvtyiqveaptgtfiasgvvvgkdtlltnkhvvdathgdp
    halkafpsainqdnypnggftaeqitkysgegdlaivkfspneqnkhigevvkpatmsnn
    aetqtnqnitvtgypgdkpvatmweskgkitylkgeamqydlsttggnsgspvfneknev
    igihwggvpnefngavfinenvrnflkqniedinfanddqpnnpdnpdnpnnpdnpnnpd
    npnnpdepnnpdnpnnpdnpdngdnnnsdnpdaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qy6A (A:)
    vilpnndrhqitdttnghyapvtyiqveaptgtfiasgvvvgkdtlltnkhvvdathgdp
    halkafpsainqdnypnggftaeqitkysgegdlaivkfspneqnkhigevvkpatmsnn
    aetqtnqnitvtgypgdkpvatmweskgkitylkgeamqydlsttggnsgspvfneknev
    igihwggvpnefngavfinenvrnflkqniedinfa