Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Thiol peroxidase Tpx [102452] (4 species) |
Species Escherichia coli [TaxId:562] [102453] (1 PDB entry) |
Domain d1qxha_: 1qxh A: [96528] |
PDB Entry: 1qxh (more details), 2.2 Å
SCOPe Domain Sequences for d1qxha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} sqtvhfqgnpvtvansipqagskaqtftlvakdlsdvtlgqfagkrkvlnifpsidtgvc aasvrkfnqlateidntvvlcisadlpfaqsrfcgaeglnnvitlstfrnaeflqaygva iadgplkglaaravvvidendnvifsqlvdeittepdyeaalav
Timeline for d1qxha_: