Lineage for d1qgpa_ (1qgp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693367Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
    Pfam PF02295
  6. 2693378Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species)
  7. 2693379Species Human (Homo sapiens) [TaxId:9606] [46855] (8 PDB entries)
  8. 2693399Domain d1qgpa_: 1qgp A: [16158]

Details for d1qgpa_

PDB Entry: 1qgp (more details)

PDB Description: nmr structure of the z-alpha domain of adar1, 15 structures
PDB Compounds: (A:) protein (double stranded RNA adenosine deaminase)

SCOPe Domain Sequences for d1qgpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qgpa_ a.4.5.19 (A:) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}
lsshfqelsiyqdqeqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgkl
qkeagtpplwkiavsd

SCOPe Domain Coordinates for d1qgpa_:

Click to download the PDB-style file with coordinates for d1qgpa_.
(The format of our PDB-style files is described here.)

Timeline for d1qgpa_: