Lineage for d1q7qa2 (1q7q A:1-300)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840803Superfamily c.1.26: Homocysteine S-methyltransferase [82282] (1 family) (S)
  5. 2840804Family c.1.26.1: Homocysteine S-methyltransferase [82283] (2 proteins)
    Pfam PF02574
  6. 2840820Protein Cobalamin-dependent methionine synthase MetH, N-terminal domain [102108] (1 species)
    5-methyltetrahydrofolate homocysteine S-methyltransferase
  7. 2840821Species Thermotoga maritima [TaxId:2336] [102109] (8 PDB entries)
  8. 2840836Domain d1q7qa2: 1q7q A:1-300 [96051]
    Other proteins in same PDB: d1q7qa1, d1q7qb1

Details for d1q7qa2

PDB Entry: 1q7q (more details), 3.1 Å

PDB Description: cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic)
PDB Compounds: (A:) 5-methyltetrahydrofolate S-homocysteine methyltransferase

SCOPe Domain Sequences for d1q7qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q7qa2 c.1.26.1 (A:1-300) Cobalamin-dependent methionine synthase MetH, N-terminal domain {Thermotoga maritima [TaxId: 2336]}
mrnrrevskllservllldgaygtefmkygyddlpeelnikapdvvlkvhrsyiesgsdv
iltntfgatrmklrkhgledkldpivrnavriarraageklvfgdigptgelpyplgstl
feefyenfretveimveegvdgiifetfsdilelkaavlaarevsrdvfliahmtfdekg
rsltgtdpanfaitfdeldidalgincslgpeeilpifqelsqytdkflvvepnagkpiv
engktvyplkphdfavhidsyyelgvnifggccgttpehvklfrkvlgnrkplqrkkkri

SCOPe Domain Coordinates for d1q7qa2:

Click to download the PDB-style file with coordinates for d1q7qa2.
(The format of our PDB-style files is described here.)

Timeline for d1q7qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q7qa1