Lineage for d1q7qb1 (1q7q B:301-558)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089689Superfamily c.1.21: Dihydropteroate synthetase-like [51717] (3 families) (S)
  5. 2089788Family c.1.21.2: Methyltetrahydrofolate-utiluzing methyltransferases [51723] (3 protein domains)
  6. 2089789Protein Cobalamin-dependent methionine synthase MetH, C-terminal domain [102104] (1 species)
    5-methyltetrahydrofolate homocysteine S-methyltransferase
  7. 2089790Species Thermotoga maritima [TaxId:2336] [102105] (8 PDB entries)
  8. 2089806Domain d1q7qb1: 1q7q B:301-558 [96052]
    Other proteins in same PDB: d1q7qa2, d1q7qb2

Details for d1q7qb1

PDB Entry: 1q7q (more details), 3.1 Å

PDB Description: cobalamin-dependent methionine synthase (1-566) from t. maritima (oxidized, orthorhombic)
PDB Compounds: (B:) 5-methyltetrahydrofolate S-homocysteine methyltransferase

SCOPe Domain Sequences for d1q7qb1:

Sequence, based on SEQRES records: (download)

>d1q7qb1 c.1.21.2 (B:301-558) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
aegkpvevlktiefisskgfnttvglsnlsfglpdrsyyntaflvlgiskglssaimnpl
detlmktlnatlvilekk

Sequence, based on observed residues (ATOM records): (download)

>d1q7qb1 c.1.21.2 (B:301-558) Cobalamin-dependent methionine synthase MetH, C-terminal domain {Thermotoga maritima [TaxId: 2336]}
favsspsklvtfdhfvvigerinpagrkklwaemqkgneeivikeaktqvekgaevldvn
fgiesqidvryvekivqtlpyvsnvplsldiqnvdlteralraypgrslfnsakvdeeel
emkinllkkyggtlivllmgkdvpksfeerkeyfekalkilerhdfsdrvifdpgvlplg
aegkpvevlktiefisskgfnttvglsnlrsyyntaflvlgiskglssaimnpldetlmk
tlnatlvilekk

SCOPe Domain Coordinates for d1q7qb1:

Click to download the PDB-style file with coordinates for d1q7qb1.
(The format of our PDB-style files is described here.)

Timeline for d1q7qb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1q7qb2