| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.223: Polo-box domain [82614] (1 superfamily) beta(6)-alpha; antiparallel beta-sheet, meander |
Superfamily d.223.1: Polo-box domain [82615] (2 families) ![]() Serine/threonine protein kinase-associated motif embedded in two distinct folds |
| Family d.223.1.2: Polo-box duplicated region [102856] (1 protein) duplication: consists of two polo-box domains; binds phosphothreonine peptide |
| Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [102858] (6 PDB entries) |
| Domain d1q4kb1: 1q4k B:371-500 [95799] |
PDB Entry: 1q4k (more details), 2.3 Å
SCOPe Domain Sequences for d1q4kb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q4kb1 d.223.1.2 (B:371-500) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdn
svgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehl
lkaganitpr
Timeline for d1q4kb1:
View in 3DDomains from other chains: (mouse over for more information) d1q4ka1, d1q4ka2, d1q4kc1, d1q4kc2 |