SCOPe 2.01: Domain d1q4kb1: 1q4k B:371-500

Lineage for d1q4kb1 (1q4k B:371-500)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.223: Polo-box domain [82614] (1 superfamily)
   beta(6)-alpha; antiparallel beta-sheet, meander

4. Superfamily d.223.1: Polo-box domain [82615] (2 families)
   Serine/threonine protein kinase-associated motif embedded in two distinct folds

5. Family d.223.1.2: Polo-box duplicated region [102856] (1 protein)
   duplication: consists of two polo-box domains; binds phosphothreonine peptide

6. Protein Serine/threonine-protein kinase plk C-terminal domain [102857] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102858] (6 PDB entries)

8. Domain d1q4kb1: 1q4k B:371-500 [95799]

Details for d1q4kb1

PDB Entry: 1q4k, 2.3 Å

PDB Description: The polo-box domain of Plk1 in complex with a phospho-peptide

PDB Compounds: (B:) Serine/threonine-protein kinase PLK

SCOPe Domain Sequences for d1q4kb1:

Sequence; same for both SEQRES and ATOM records:

>d1q4kb1 d.223.1.2 (B:371-500) Serine/threonine-protein kinase plk C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dchlsdmlqqlhsvnaskpserglvrqeeaedpacipifwvskwvdysdkyglgyqlcdn
svgvlfndstrlilyndgdslqyierdgtesyltvsshpnslmkkitllkyfrnymsehl
lkaganitpr

Timeline for d1q4kb1:

• d1q4kb1 first appeared in SCOP 1.67
  
• d1q4kb1 appears in SCOP 1.75
  
• d1q4kb1 appears in SCOPe 2.02
  
• d1q4kb1 appears in the current release, SCOPe 2.08