Lineage for d1pufb_ (1puf B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305224Family a.4.1.1: Homeodomain [46690] (41 proteins)
    Pfam PF00046
  6. 2305374Protein pbx1 [46711] (2 species)
  7. 2305375Species Human (Homo sapiens) [TaxId:9606] [46712] (2 PDB entries)
  8. 2305376Domain d1pufb_: 1puf B: [95132]
    Other proteins in same PDB: d1pufa_
    protein/DNA complex

Details for d1pufb_

PDB Entry: 1puf (more details), 1.9 Å

PDB Description: Crystal Structure of HoxA9 and Pbx1 homeodomains bound to DNA
PDB Compounds: (B:) Pre-B-cell leukemia transcription factor-1

SCOPe Domain Sequences for d1pufb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]}
arrkrrnfnkqateilneyfyshlsnpypseeakeelakkcgitvsqvsnwfgnkriryk
knigkfqeeaniy

SCOPe Domain Coordinates for d1pufb_:

Click to download the PDB-style file with coordinates for d1pufb_.
(The format of our PDB-style files is described here.)

Timeline for d1pufb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pufa_