Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) the constituent families form similar dimers |
Family c.77.1.3: PdxA-like [102656] (2 proteins) Pfam PF04166; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PlsX-like and phosphotransacetylase families |
Protein 4-hydroxythreonine-4-phosphate dehydrogenase PdxA [102657] (2 species) pyridoxal phosphate biosynthetic protein |
Species Escherichia coli [TaxId:562] [102658] (3 PDB entries) |
Domain d1ps6a_: 1ps6 A: [95070] complexed with 4tp, zn |
PDB Entry: 1ps6 (more details), 2.25 Å
SCOPe Domain Sequences for d1ps6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ps6a_ c.77.1.3 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Escherichia coli [TaxId: 562]} vktqrvvitpgepagigpdlvvqlaqrewpvelvvcadatlltnraamlglpltlrpysp nspaqpqtagtltllpvalrapvtagqlavenghyvvetlaracdgclngefaalitgpv hkgvindagipftghteffeersqakkvvmmlateelrvalatthlplrdiadaitpall heviailhhdlrtkfgiaeprilvcglnphagegghmgteeidtiipvlnelraqgmkln gplpadtlfqpkyldnadavlamyhdqglpvlkyqgfgrgvnitlglpfirtsvdhgtal elagrgkadvgsfitalnlaikmivntq
Timeline for d1ps6a_: