SCOP 1.67: Domain d1ps6a_: 1ps6 A:

Lineage for d1ps6a_ (1ps6 A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
   consists of two intertwined (sub)domains related by pseudo dyad; duplication
   3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest

4. Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (5 families)
   the constituent families form similar dimers

5. Family c.77.1.3: PdxA-like [102656] (1 protein)
   Pfam 04166; contains extra beta-alpha unit between strands 2 and 3; closer relationships to the PlsX-like and phosphotransacetylase families

6. Protein 4-hydroxythreonine-4-phosphate dehydrogenase PdxA [102657] (2 species)
   pyridoxal phosphate biosynthetic protein

7. Species Escherichia coli [TaxId:562] [102658] (3 PDB entries)

8. Domain d1ps6a_: 1ps6 A: [95070]

Details for d1ps6a_

PDB Entry: 1ps6, 2.25 Å

PDB Description: crystal structure of e.coli pdxa

SCOP Domain Sequences for d1ps6a_:

Sequence; same for both SEQRES and ATOM records:

>d1ps6a_ c.77.1.3 (A:) 4-hydroxythreonine-4-phosphate dehydrogenase PdxA {Escherichia coli}
vktqrvvitpgepagigpdlvvqlaqrewpvelvvcadatlltnraamlglpltlrpysp
nspaqpqtagtltllpvalrapvtagqlavenghyvvetlaracdgclngefaalitgpv
hkgvindagipftghteffeersqakkvvmmlateelrvalatthlplrdiadaitpall
heviailhhdlrtkfgiaeprilvcglnphagegghmgteeidtiipvlnelraqgmkln
gplpadtlfqpkyldnadavlamyhdqglpvlkyqgfgrgvnitlglpfirtsvdhgtal
elagrgkadvgsfitalnlaikmivntq

Timeline for d1ps6a_:

• d1ps6a_ is new in SCOP 1.67
  
• d1ps6a_ appears in SCOP 1.69
  
• d1ps6a_ appears in the current release, SCOPe 2.08