| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) ![]() less regular structure consisting of variable repeats |
| Family c.10.2.7: Ngr ectodomain-like [75142] (7 proteins) this is a repeat family; one repeat unit is 1xwd C:97-122 found in domain |
| Protein Reticulon 4 receptor (Nogo-66 receptor, Ngr) [89567] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89568] (2 PDB entries) |
| Domain d1p8ta_: 1p8t A: [87982] complexed with nag, ndg |
PDB Entry: 1p8t (more details), 3.2 Å
SCOPe Domain Sequences for d1p8ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p8ta_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}
cpgacvcynepkvttscpqqglqavpvgipaasqriflhgnrishvpaasfracrnltil
wlhsnvlaridaaaftglalleqldlsdnaqlrsvdpatfhglgrlhtlhldrcglqelg
pglfrglaalqylylqdnalqalpddtfrdlgnlthlflhgnrissvperafrglhsldr
lllhqnrvahvhphafrdlgrlmtlylfannlsalptealaplralqylrlndnpwvcdc
rarplwawlqkfrgsssevpcslpqrlagrdlkrlaandlqgcav
Timeline for d1p8ta_: