SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1p8ta_ (1p8t A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2098542Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
    2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
  4. 2098611Superfamily c.10.2: L domain-like [52058] (9 families) (S)
    less regular structure consisting of variable repeats
  5. 2098754Family c.10.2.7: Ngr ectodomain-like [75142] (7 protein domains)
  6. 2098769Protein Reticulon 4 receptor (Nogo-66 receptor, Ngr) [89567] (1 species)
  7. 2098770Species Human (Homo sapiens) [TaxId:9606] [89568] (2 PDB entries)
  8. 2098772Domain d1p8ta_: 1p8t A: [87982]
    complexed with nag, ndg

Details for d1p8ta_

PDB Entry: 1p8t (more details), 3.2 Å

PDB Description: Crystal structure of Nogo-66 Receptor
PDB Compounds: (A:) Reticulon 4 receptor

SCOPe Domain Sequences for d1p8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1p8ta_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]}
cpgacvcynepkvttscpqqglqavpvgipaasqriflhgnrishvpaasfracrnltil
wlhsnvlaridaaaftglalleqldlsdnaqlrsvdpatfhglgrlhtlhldrcglqelg
pglfrglaalqylylqdnalqalpddtfrdlgnlthlflhgnrissvperafrglhsldr
lllhqnrvahvhphafrdlgrlmtlylfannlsalptealaplralqylrlndnpwvcdc
rarplwawlqkfrgsssevpcslpqrlagrdlkrlaandlqgcav

SCOPe Domain Coordinates for d1p8ta_:

Click to download the PDB-style file with coordinates for d1p8ta_.
(The format of our PDB-style files is described here.)

Timeline for d1p8ta_: