Lineage for d1p65a_ (1p65 A:)
- Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.254: Nucleocapsid protein dimerization domain [103067] (1 superfamily)
dimer of alpha-beta(2)-alpha motifs ; 2 layers, alpha/betaSuperfamily d.254.1: Nucleocapsid protein dimerization domain [103068] (2 families) 
Family d.254.1.1: Arterivirus nucleocapsid protein [103069] (1 protein) Protein Arterivirus nucleocapsid protein [103070] (2 species) 
Species PRRSV (Porcine reproductive and respiratory syndrome virus) [TaxId:28344] [103071] (1 PDB entry) 
Domain d1p65a_: 1p65 A: [94156]
Details for d1p65a_
PDB Entry: 1p65 (more details), 2.6 Å
PDB Description: Crystal structure of the nucleocapsid protein of porcine reproductive and respiratory syndrome virus (PRRSV)
PDB Compounds: (A:) nucleocapsid proteinSCOP Domain Sequences for d1p65a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1p65a_ d.254.1.1 (A:) Arterivirus nucleocapsid protein {PRRSV (Porcine reproductive and respiratory syndrome virus) [TaxId: 28344]}
dvrhhftpserqlclssiqtafnqgagtctlsdsgrisytvefslpthhtvrlirvt
SCOP Domain Coordinates for d1p65a_:
Click to download the PDB-style file with coordinates for d1p65a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1p65a_:
- d1p65a_ first appeared in SCOP 1.67
- d1p65a_ appears in SCOP 1.73
- d1p65a_ appears in SCOPe 2.01
- d1p65a_ appears in the current release, SCOPe 2.08
View in 3D
