Lineage for d1oula_ (1oul A:)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.136: SspB-like [101737] (1 superfamily)
core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like foldSuperfamily b.136.1: SspB-like [101738] (3 families) 
Family b.136.1.1: Stringent starvation protein B, SspB [101739] (2 proteins)
automatically mapped to Pfam PF04386Protein Stringent starvation protein B, SspB [101740] (2 species)
a specificity-enhancing factor for the ClpXP proteolytic machineSpecies Haemophilus influenzae [TaxId:727] [101742] (5 PDB entries)
Uniprot P45206 5-110
Domain d1oula_: 1oul A: [93549]
Details for d1oula_
PDB Entry: 1oul (more details), 2.2 Å
PDB Description: Structure of the AAA+ protease delivery protein SspB
PDB Compounds: (A:) Stringent starvation protein B homologSCOPe Domain Sequences for d1oula_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oula_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Haemophilus influenzae [TaxId: 727]}
meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteq
pt
SCOPe Domain Coordinates for d1oula_:
Click to download the PDB-style file with coordinates for d1oula_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oula_:
- d1oula_ first appeared in SCOP 1.67
- d1oula_ appears in SCOPe 2.05
- d1oula_ appears in SCOPe 2.07
- d1oula_ appears in the current release, SCOPe 2.08
View in 3D
