Lineage for d1oula_ (1oul A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383534Fold b.136: Stringent starvation protein B, SspB [101737] (1 superfamily)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology; some similarity to the Sm-like fold
  4. 383535Superfamily b.136.1: Stringent starvation protein B, SspB [101738] (1 family) (S)
  5. 383536Family b.136.1.1: Stringent starvation protein B, SspB [101739] (1 protein)
  6. 383537Protein Stringent starvation protein B, SspB [101740] (2 species)
    a specificity-enhancing factor for the ClpXP proteolytic machine
  7. 383549Species Haemophilus influenzae [TaxId:727] [101742] (3 PDB entries)
  8. 383555Domain d1oula_: 1oul A: [93549]

Details for d1oula_

PDB Entry: 1oul (more details), 2.2 Å

PDB Description: Structure of the AAA+ protease delivery protein SspB

SCOP Domain Sequences for d1oula_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oula_ b.136.1.1 (A:) Stringent starvation protein B, SspB {Haemophilus influenzae}
meyksspkrpyllrayydwlvdnsftpylvvdatylgvnvpveyvkdgqivlnlsasatg
nlqltndfiqfnarfkgvsrelyipmgaalaiyarengdgvmfepeeiydelniepdteq
pt

SCOP Domain Coordinates for d1oula_:

Click to download the PDB-style file with coordinates for d1oula_.
(The format of our PDB-style files is described here.)

Timeline for d1oula_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1oulb_