Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
Superfamily d.211.1: Ankyrin repeat [48403] (2 families) repeats organized in elongated structures |
Family d.211.1.1: Ankyrin repeat [48404] (19 proteins) this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain |
Protein Neurogenic locus notch receptor domain [102879] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102880] (1 PDB entry) |
Domain d1ot8a_: 1ot8 A: [93507] complexed with mg |
PDB Entry: 1ot8 (more details), 2 Å
SCOPe Domain Sequences for d1ot8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} taqvisdllaqgaelnatmdktgetslhlaarfaradaakrlldagadansqdntgrtpl haavaadamgvfqillrnratnlnarmhdgttplilaarlaiegmvedlitadadinaad nsgktalhwaaavnnteavnillmhhanrdaqddkdetplflaaregsyeaskalldnfa nreitdhmdrlprdvaserlhhdivrlld
Timeline for d1ot8a_: