Lineage for d1ot8a_ (1ot8 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238947Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2238948Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2238949Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 2239009Protein Neurogenic locus notch receptor domain [102879] (1 species)
  7. 2239010Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102880] (1 PDB entry)
  8. 2239011Domain d1ot8a_: 1ot8 A: [93507]
    complexed with mg

Details for d1ot8a_

PDB Entry: 1ot8 (more details), 2 Å

PDB Description: structure of the ankyrin domain of the drosophila notch receptor
PDB Compounds: (A:) Neurogenic locus Notch protein

SCOPe Domain Sequences for d1ot8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
taqvisdllaqgaelnatmdktgetslhlaarfaradaakrlldagadansqdntgrtpl
haavaadamgvfqillrnratnlnarmhdgttplilaarlaiegmvedlitadadinaad
nsgktalhwaaavnnteavnillmhhanrdaqddkdetplflaaregsyeaskalldnfa
nreitdhmdrlprdvaserlhhdivrlld

SCOPe Domain Coordinates for d1ot8a_:

Click to download the PDB-style file with coordinates for d1ot8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ot8a_: