Lineage for d1ot8a_ (1ot8 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422776Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 422777Superfamily d.211.1: Ankyrin repeat [48403] (1 family) (S)
    repeats organized in elongated structures
  5. 422778Family d.211.1.1: Ankyrin repeat [48404] (14 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 422822Protein Neurogenic locus notch receptor domain [102879] (1 species)
  7. 422823Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [102880] (1 PDB entry)
  8. 422824Domain d1ot8a_: 1ot8 A: [93507]

Details for d1ot8a_

PDB Entry: 1ot8 (more details), 2 Å

PDB Description: structure of the ankyrin domain of the drosophila notch receptor

SCOP Domain Sequences for d1ot8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster)}
taqvisdllaqgaelnatmdktgetslhlaarfaradaakrlldagadansqdntgrtpl
haavaadamgvfqillrnratnlnarmhdgttplilaarlaiegmvedlitadadinaad
nsgktalhwaaavnnteavnillmhhanrdaqddkdetplflaaregsyeaskalldnfa
nreitdhmdrlprdvaserlhhdivrlld

SCOP Domain Coordinates for d1ot8a_:

Click to download the PDB-style file with coordinates for d1ot8a_.
(The format of our PDB-style files is described here.)

Timeline for d1ot8a_: