Lineage for d1oqcb_ (1oqc B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1083284Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1083889Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 1083890Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)
  6. 1083891Protein Augmenter of liver regeneration [89018] (2 species)
    a mammalian FAD-dependent sulfhydryl oxidase
  7. 1083896Species Norway rat (Rattus norvegicus) [TaxId:10116] [89019] (1 PDB entry)
  8. 1083898Domain d1oqcb_: 1oqc B: [87265]
    complexed with fad

Details for d1oqcb_

PDB Entry: 1oqc (more details), 1.8 Å

PDB Description: The crystal structure of augmenter of liver regeneration: a mammalian FAD dependent sulfhydryl oxidase
PDB Compounds: (B:) Augmenter of liver regeneration

SCOPe Domain Sequences for d1oqcb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oqcb_ a.24.15.1 (B:) Augmenter of liver regeneration {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkri
drsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc

SCOPe Domain Coordinates for d1oqcb_:

Click to download the PDB-style file with coordinates for d1oqcb_.
(The format of our PDB-style files is described here.)

Timeline for d1oqcb_: