Lineage for d1okja1 (1okj A:1-106)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1605902Family c.55.1.9: YeaZ-like [110633] (2 proteins)
    Pfam PF00814; ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known extracellular activity
  6. 1605909Protein Hypothetical protein YeaZ [110634] (1 species)
  7. 1605910Species Escherichia coli [TaxId:562] [110635] (1 PDB entry)
    Uniprot P76256
  8. 1605911Domain d1okja1: 1okj A:1-106 [103998]
    complexed with gd3

Details for d1okja1

PDB Entry: 1okj (more details), 2.28 Å

PDB Description: crystal structure of the essential E. coli YeaZ protein by MAD method using the gadolinium complex "DOTMA"
PDB Compounds: (A:) tRNA threonylcarbamoyladenosine biosynthesis protein tsab

SCOPe Domain Sequences for d1okja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]}
rilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinalay
grgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkng

SCOPe Domain Coordinates for d1okja1:

Click to download the PDB-style file with coordinates for d1okja1.
(The format of our PDB-style files is described here.)

Timeline for d1okja1: