Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab11a [102362] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [102363] (4 PDB entries) |
Domain d1oiwa_: 1oiw A: [93078] complexed with gsp, mg |
PDB Entry: 1oiw (more details), 2.05 Å
SCOPe Domain Sequences for d1oiwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oiwa_ c.37.1.8 (A:) Rab11a {Human (Homo sapiens) [TaxId: 9606]} ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt agleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd lrhlravptdearafaeknglsfietsaldstnveaafqtilteiy
Timeline for d1oiwa_: