Lineage for d1oiwa_ (1oiw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867378Protein Rab11a [102362] (2 species)
  7. 2867385Species Human (Homo sapiens) [TaxId:9606] [102363] (4 PDB entries)
  8. 2867391Domain d1oiwa_: 1oiw A: [93078]
    complexed with gsp, mg

Details for d1oiwa_

PDB Entry: 1oiw (more details), 2.05 Å

PDB Description: x-ray structure of the small g protein rab11a in complex with gtpgammas
PDB Compounds: (A:) Ras-related protein Rab-11A

SCOPe Domain Sequences for d1oiwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oiwa_ c.37.1.8 (A:) Rab11a {Human (Homo sapiens) [TaxId: 9606]}
ydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwdt
agleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
lrhlravptdearafaeknglsfietsaldstnveaafqtilteiy

SCOPe Domain Coordinates for d1oiwa_:

Click to download the PDB-style file with coordinates for d1oiwa_.
(The format of our PDB-style files is described here.)

Timeline for d1oiwa_: