Lineage for d1oi7a2 (1oi7 A:122-288)
- Root: SCOPe 2.01
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (1 family) 
Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 proteins)
contain additional N-terminal strand "0", antiparallel to strand 2Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (3 species) Species Thermus thermophilus [TaxId:274] [89589] (1 PDB entry) 
Domain d1oi7a2: 1oi7 A:122-288 [87050]
Other proteins in same PDB: d1oi7a1
alpha-chain only
Details for d1oi7a2
PDB Entry: 1oi7 (more details), 1.23 Å
PDB Description: the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus
PDB Compounds: (A:) succinyl-coa synthetase alpha chainSCOPe Domain Sequences for d1oi7a2:
Sequence, based on SEQRES records: (download)
>d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapkg
krmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg
Sequence, based on observed residues (ATOM records): (download)
>d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrvgtpe
sklrafaeagipvadtideivelvkkalg
SCOPe Domain Coordinates for d1oi7a2:
Click to download the PDB-style file with coordinates for d1oi7a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oi7a2:
- d1oi7a2 first appeared in SCOP 1.65
- d1oi7a2 appears in SCOP 1.75
- d1oi7a2 appears in SCOPe 2.02
- d1oi7a2 appears in the current release, SCOPe 2.08
View in 3D
