Lineage for d1oi7a2 (1oi7 A:122-288)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102261Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2102262Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 protein domains)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2102269Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species)
  7. 2102307Species Thermus thermophilus [TaxId:274] [89589] (1 PDB entry)
  8. 2102308Domain d1oi7a2: 1oi7 A:122-288 [87050]
    Other proteins in same PDB: d1oi7a1
    alpha-chain only

Details for d1oi7a2

PDB Entry: 1oi7 (more details), 1.23 Å

PDB Description: the crystal structure of succinyl-coa synthetase alpha subunit from thermus thermophilus
PDB Compounds: (A:) succinyl-coa synthetase alpha chain

SCOPe Domain Sequences for d1oi7a2:

Sequence, based on SEQRES records: (download)

>d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrsapkg
krmghagaiimgnvgtpesklrafaeagipvadtideivelvkkalg

Sequence, based on observed residues (ATOM records): (download)

>d1oi7a2 c.23.4.1 (A:122-288) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Thermus thermophilus [TaxId: 274]}
ncpgiisaeetkigimpghvfkrgrvgiisrsgtltyeaaaalsqaglgttttvgiggdp
vigttfkdllplfnedpeteavvligeiggsdeeeaaawvkdhmkkpvvgfiggrvgtpe
sklrafaeagipvadtideivelvkkalg

SCOPe Domain Coordinates for d1oi7a2:

Click to download the PDB-style file with coordinates for d1oi7a2.
(The format of our PDB-style files is described here.)

Timeline for d1oi7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oi7a1