Lineage for d1oi1a1 (1oi1 A:33-135)
- Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds) 
Fold b.34: SH3-like barrel [50036] (21 superfamilies)
barrel, partly opened; n*=4, S*=8; meander
the last strand is interrupted by a turn of 3-10 helix
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) 
Family b.34.9.3: MBT repeat [89299] (4 proteins)
Pfam PF02820
contains extended 'arm', N-terminal to the common fold core
Protein Scml2 protein [89300] (1 species)
duplication: contains tandem repeat of two MBT repeatsSpecies Human (Homo sapiens) [TaxId:9606] [89301] (2 PDB entries) 
Domain d1oi1a1: 1oi1 A:33-135 [87037]
complexed with peg
Details for d1oi1a1
PDB Entry: 1oi1 (more details), 1.78 Å
PDB Description: crystal structure of the mbt domains of human scml2
PDB Compounds: (A:) scml2 proteinSCOPe Domain Sequences for d1oi1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens) [TaxId: 9606]}
fhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitgar
lrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyq
SCOPe Domain Coordinates for d1oi1a1:
Click to download the PDB-style file with coordinates for d1oi1a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1oi1a1:
- d1oi1a1 first appeared in SCOP 1.65
- d1oi1a1 appears in SCOPe 2.05
- d1oi1a1 appears in SCOPe 2.07
- d1oi1a1 appears in the current release, SCOPe 2.08
View in 3D
