SCOP 1.65: Domain d1oi1a1: 1oi1 A:33-135

Lineage for d1oi1a1 (1oi1 A:33-135)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.34: SH3-like barrel [50036] (13 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (3 families)

5. Family b.34.9.3: MBT repeat [89299] (1 protein)
   contains extended 'arm', N-terminal to the common fold core

6. Protein Scml2 protein [89300] (1 species)
   duplication: contains tandem repeat of two MBT repeats

7. Species Human (Homo sapiens) [TaxId:9606] [89301] (1 PDB entry)

8. Domain d1oi1a1: 1oi1 A:33-135 [87037]

Details for d1oi1a1

PDB Entry: 1oi1, 1.78 Å

PDB Description: crystal structure of the mbt domains of human scml2

SCOP Domain Sequences for d1oi1a1:

Sequence; same for both SEQRES and ATOM records:

>d1oi1a1 b.34.9.3 (A:33-135) Scml2 protein {Human (Homo sapiens)}
fhweeylketgsisapsecfrqsqippvndfkvgmkleardprnatsvciatvigitgar
lrlrldgsdnrndfwrlvdspdiqpvgtcekegdllqpplgyq

Timeline for d1oi1a1:

• d1oi1a1 is new in SCOP 1.65
  
• d1oi1a1 appears in SCOP 1.67
  
• d1oi1a1 appears in the current release, SCOPe 2.08