SCOP 1.75: Domain d1o7aa2: 1o7a A:54-199

Lineage for d1o7aa2 (1o7a A:54-199)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.92: Zincin-like [55485] (2 superfamilies)
contains mixed beta sheet with connection over free side of the sheet
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families)
contains similar fold but lacks its catalytic centre
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins)
family GH20
Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries)
Domain d1o7aa2: 1o7a A:54-199 [92609]
Other proteins in same PDB: d1o7aa1, d1o7ab1, d1o7ac1, d1o7ad1, d1o7ae1, d1o7af1

Details for d1o7aa2

PDB Entry: 1o7a (more details), 2.25 Å

PDB Description: human beta-hexosaminidase b

PDB Compounds: (A:) beta-hexosaminidase beta chain

SCOP Domain Sequences for d1o7aa2:

Sequence, based on SEQRES records: (download)

>d1o7aa2 d.92.2.1 (A:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh
epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle
tfsqlvyqdsygtftinestiidspr

Sequence, based on observed residues (ATOM records): (download)

>d1o7aa2 d.92.2.1 (A:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql
lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf
tinestiidspr

SCOP Domain Coordinates for d1o7aa2:

Click to download the PDB-style file with coordinates for d1o7aa2.
(The format of our PDB-style files is described here.)

Timeline for d1o7aa2: