Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.1: beta-N-acetylhexosaminidase domain [55546] (4 proteins) family GH20 |
Protein beta-hexosaminidase B, N-terminal domain [89992] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89993] (6 PDB entries) |
Domain d1o7af2: 1o7a F:54-199 [92619] Other proteins in same PDB: d1o7aa1, d1o7ab1, d1o7ac1, d1o7ad1, d1o7ae1, d1o7af1 complexed with edo, gdl, nag |
PDB Entry: 1o7a (more details), 2.25 Å
SCOP Domain Sequences for d1o7af2:
Sequence, based on SEQRES records: (download)
>d1o7af2 d.92.2.1 (F:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgfykwhh epaefqaktqvqqllvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgle tfsqlvyqdsygtftinestiidspr
>d1o7af2 d.92.2.1 (F:54-199) beta-hexosaminidase B, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} palwplplsvkmtpnllhlapenfyishspnstagpsctlleeafrryhgyifgtqvqql lvsitlqsecdafpnissdesytllvkepvavlkanrvwgalrgletfsqlvyqdsygtf tinestiidspr
Timeline for d1o7af2: