Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein Uracil PRTase, Upp [53293] (5 species) |
Species Thermotoga maritima [TaxId:2336] [102538] (1 PDB entry) TM0721 |
Domain d1o5oa_: 1o5o A: [92509] structural genomics complexed with so4, u5p |
PDB Entry: 1o5o (more details), 2.3 Å
SCOPe Domain Sequences for d1o5oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} hmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpi tktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklp plnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvki yvaalderlndhgyiipglgdagdrlfrtk
Timeline for d1o5oa_: