SCOP 1.67: Domain d1o5oa_: 1o5o A:

Lineage for d1o5oa_ (1o5o A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (2 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (10 proteins)

6. Protein Uracil PRTase [53293] (5 species)

7. Species Thermotoga maritima [TaxId:243274] [102538] (1 PDB entry)
   TM0721

8. Domain d1o5oa_: 1o5o A: [92509]

Details for d1o5oa_

PDB Entry: 1o5o, 2.3 Å

PDB Description: crystal structure of uracil phosphoribosyltransferase (tm0721) from thermotoga maritima at 2.30 a resolution

SCOP Domain Sequences for d1o5oa_:

Sequence; same for both SEQRES and ATOM records:

>d1o5oa_ c.61.1.1 (A:) Uracil PRTase {Thermotoga maritima}
hmknlvvvdhplikhkltimrdkntgpkefrellreitlllayeatrhlkceevevetpi
tktigyrindkdivvvpilraglvmadgilellpnasvghigiyrdpetlqaveyyaklp
plnddkevflldpmlatgvssikaieilkengakkitlvaliaapegveavekkyedvki
yvaalderlndhgyiipglgdagdrlfrtk

Timeline for d1o5oa_:

• d1o5oa_ is new in SCOP 1.67
  
• d1o5oa_ appears in SCOP 1.69
  
• d1o5oa_ appears in the current release, SCOPe 2.08, called d1o5oa1