Lineage for d1o26b_ (1o26 B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685571Fold d.207: Thymidylate synthase-complementing protein Thy1 [69795] (1 superfamily)
    complex alpha+beta fold; contains antiparallel 5-stranded beta-sheet: order 12354
  4. 1685572Superfamily d.207.1: Thymidylate synthase-complementing protein Thy1 [69796] (1 family) (S)
    automatically mapped to Pfam PF02511
  5. 1685573Family d.207.1.1: Thymidylate synthase-complementing protein Thy1 [69797] (2 proteins)
  6. 1685574Protein Thy1 homologue [69798] (1 species)
  7. 1685575Species Thermotoga maritima [TaxId:2336] [69799] (22 PDB entries)
    TM0449
  8. 1685579Domain d1o26b_: 1o26 B: [86567]
    structural genomics
    complexed with fad, pge, ump

Details for d1o26b_

PDB Entry: 1o26 (more details), 1.6 Å

PDB Description: crystal structure of thymidylate synthase complementing protein (tm0449) from thermotoga maritima with fad and dump at 1.6 a resolution
PDB Compounds: (B:) Thymidylate synthase thyX

SCOPe Domain Sequences for d1o26b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o26b_ d.207.1.1 (B:) Thy1 homologue {Thermotoga maritima [TaxId: 2336]}
hmkidildkgfvelvdvmgndlsavraarvsfdmglkdeerdrhlieylmkhghetpfeh
ivftfhvkapifvarqwfrhriasynelsgrysklsyefyipsperlegykttippervt
ekiseivdkayrtyleliesgvprevarivlplnlytrffwtvnarslmnflnlradsha
qweiqqyalaiarifkekcpwtfeaflkyaykgdilkevqv

SCOPe Domain Coordinates for d1o26b_:

Click to download the PDB-style file with coordinates for d1o26b_.
(The format of our PDB-style files is described here.)

Timeline for d1o26b_: