Class b: All beta proteins [48724] (176 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins) |
Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species) |
Species Thermus thermophilus [TaxId:274] [101696] (1 PDB entry) |
Domain d1nz9a_: 1nz9 A: [92364] C-terminal domain (Ngc) only |
PDB Entry: 1nz9 (more details)
SCOPe Domain Sequences for d1nz9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]} aqvafregdqvrvvsgpfadftgtvteinpergkvkvmvtifgretpveldfsqvvka
Timeline for d1nz9a_: