PDB entry 1nz9

View 1nz9 on RCSB PDB site
Description: Solution Structure of the N-utilisation substance G (NusG) C-terminal (NGC) domain from Thermus thermophilus
Class: transcription
Keywords: TRANSCRIPTION ELONGATION, TERMINATION, ANTITERMINATION, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2003-02-17, released 2004-04-06
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription antitermination protein nusG
    Species: Thermus thermophilus [TaxId:274]
    Gene: NusG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1nz9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nz9A (A:)
aqvafregdqvrvvsgpfadftgtvteinpergkvkvmvtifgretpveldfsqvvka