Lineage for d1nz9a_ (1nz9 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536931Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1537181Family b.34.5.4: N-utilization substance G protein NusG, C-terminal domain [82072] (2 proteins)
  6. 1537182Protein N-utilization substance G protein NusG, C-terminal domain [82073] (3 species)
  7. 1537195Species Thermus thermophilus [TaxId:274] [101696] (1 PDB entry)
  8. 1537196Domain d1nz9a_: 1nz9 A: [92364]
    C-terminal domain (Ngc) only

Details for d1nz9a_

PDB Entry: 1nz9 (more details)

PDB Description: solution structure of the n-utilization substance g (nusg) c-terminal (ngc) domain from thermus thermophilus
PDB Compounds: (A:) Transcription antitermination protein nusG

SCOPe Domain Sequences for d1nz9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nz9a_ b.34.5.4 (A:) N-utilization substance G protein NusG, C-terminal domain {Thermus thermophilus [TaxId: 274]}
aqvafregdqvrvvsgpfadftgtvteinpergkvkvmvtifgretpveldfsqvvka

SCOPe Domain Coordinates for d1nz9a_:

Click to download the PDB-style file with coordinates for d1nz9a_.
(The format of our PDB-style files is described here.)

Timeline for d1nz9a_: