Lineage for d1nyxa_ (1nyx A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48525] (168 PDB entries)
    Uniprot P37231 232-505
  8. Domain d1nyxa_: 1nyx A: [86431]
    complexed with drf

Details for d1nyxa_

PDB Entry: 1nyx (more details), 2.65 Å

PDB Description: Ligand binding domain of the human peroxisome proliferator activated receptor gamma in complex with an agonist
PDB Compounds: (A:) Peroxisome proliferator activated receptor gamma

SCOPe Domain Sequences for d1nyxa_:

Sequence, based on SEQRES records: (download)

>d1nyxa_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
dqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
ikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkyg
vheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnaleldd
sdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtd
lrqivtehvqllqvikktetdmslhpllqeiykdl

Sequence, based on observed residues (ATOM records): (download)

>d1nyxa_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
dqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedk
vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
kktetdmslhpllqeiykdl

SCOPe Domain Coordinates for d1nyxa_ are not available.

Timeline for d1nyxa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nyxb_