Lineage for d1nyxb_ (1nyx B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2335636Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2335637Species Human (Homo sapiens) [TaxId:9606] [48525] (117 PDB entries)
    Uniprot P37231 232-505
  8. 2335801Domain d1nyxb_: 1nyx B: [86432]
    complexed with drf

Details for d1nyxb_

PDB Entry: 1nyx (more details), 2.65 Å

PDB Description: Ligand binding domain of the human peroxisome proliferator activated receptor gamma in complex with an agonist
PDB Compounds: (B:) Peroxisome proliferator activated receptor gamma

SCOPe Domain Sequences for d1nyxb_:

Sequence, based on SEQRES records: (download)

>d1nyxb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdl

Sequence, based on observed residues (ATOM records): (download)

>d1nyxb_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itvairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslm
nkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviils
gdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllq
vikktethpllqeiykdl

SCOPe Domain Coordinates for d1nyxb_:

Click to download the PDB-style file with coordinates for d1nyxb_.
(The format of our PDB-style files is described here.)

Timeline for d1nyxb_: