Lineage for d1nija1 (1nij A:2-223)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologiesFamily c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
core: parallel beta-sheet of 7 strands; order 3241567
Protein Hypothetical protein YjiA, N-terminal domain [89671] (1 species)
homologue of the cobalamin biosynthesis protein CobWSpecies Escherichia coli [TaxId:562] [89672] (3 PDB entries) 
Domain d1nija1: 1nij A:2-223 [85741]
Other proteins in same PDB: d1nija2
CASP5
structural genomics
has additional insertions and/or extensions that are not grouped together
Details for d1nija1
PDB Entry: 1nij (more details), 2 Å
PDB Description: yjia protein
PDB Compounds: (A:) Hypothetical protein yjiASCOPe Domain Sequences for d1nija1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}
npiavtlltgflgagkttllrhilneqhgykiavienefgevsvddqligdratqiktlt
ngciccsrsneledalldlldnldkgniqfdrlviectgmadpgpiiqtffshevlcqry
lldgvialvdavhadeqmnqftiaqsqvgyadrilltktdvageaeklherlarinarap
vytvthgdidlgllfntngfmleenvvstkprfhfiadkqnd
SCOPe Domain Coordinates for d1nija1:
Click to download the PDB-style file with coordinates for d1nija1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nija1:
- d1nija1 first appeared in SCOP 1.65
- d1nija1 appears in SCOPe 2.07
View in 3D
