Lineage for d1nexa1 (1nex A:116-185)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1507272Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 1507273Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 1507274Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 1507275Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [81910] (1 species)
    Suppressor of kinetochore protein 1,Scskp1
  7. 1507276Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81911] (2 PDB entries)
  8. 1507279Domain d1nexa1: 1nex A:116-185 [80441]
    Other proteins in same PDB: d1nexa2, d1nexb1, d1nexb2, d1nexc2, d1nexd1, d1nexd2

Details for d1nexa1

PDB Entry: 1nex (more details), 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex
PDB Compounds: (A:) Centromere DNA-binding protein complex CBF3 subunit D

SCOPe Domain Sequences for d1nexa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vdswdreflkvdqemlyeiilaanylnikplldagckvvaemirgrspeeirrtfnivnd
ftpeeeaair

SCOPe Domain Coordinates for d1nexa1:

Click to download the PDB-style file with coordinates for d1nexa1.
(The format of our PDB-style files is described here.)

Timeline for d1nexa1: