Lineage for d1nexa2 (1nex A:4-103)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647424Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 1647456Protein Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D [82639] (1 species)
    Suppressor of kinetochore protein 1,Scskp1
  7. 1647457Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [82640] (2 PDB entries)
  8. 1647460Domain d1nexa2: 1nex A:4-103 [80442]
    Other proteins in same PDB: d1nexa1, d1nexb1, d1nexb2, d1nexc1, d1nexd1, d1nexd2

Details for d1nexa2

PDB Entry: 1nex (more details), 2.7 Å

PDB Description: crystal structure of scskp1-sccdc4-cpd peptide complex
PDB Compounds: (A:) Centromere DNA-binding protein complex CBF3 subunit D

SCOPe Domain Sequences for d1nexa2:

Sequence, based on SEQRES records: (download)

>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknylndmgddddedddeivmpvpnvrssvlqkvi
ewaehhrdsnfp

Sequence, based on observed residues (ATOM records): (download)

>d1nexa2 d.42.1.1 (A:4-103) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
snvvlvsgegerftvdkkiaerslllknylivmpvpnvrssvlqkviewaehhrdsnfp

SCOPe Domain Coordinates for d1nexa2:

Click to download the PDB-style file with coordinates for d1nexa2.
(The format of our PDB-style files is described here.)

Timeline for d1nexa2: