Lineage for d1ne3a_ (1ne3 A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 798661Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 799407Superfamily b.40.4: Nucleic acid-binding proteins [50249] (16 families) (S)
  5. 799717Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (30 proteins)
    barrel, closed; n=5, S=8
  6. 800107Protein Ribosomal protein S28e [101765] (2 species)
    incomplete OB-fold lacking the last strand
  7. 800108Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [101767] (1 PDB entry)
  8. 800109Domain d1ne3a_: 1ne3 A: [91828]
    structural genomics

Details for d1ne3a_

PDB Entry: 1ne3 (more details)

PDB Description: solution structure of ribosomal protein s28e from methanobacterium thermoautotrophicum. ontario centre for structural proteomics target mth0256_1_68; northeast structural genomics target tt744
PDB Compounds: (A:) 30S ribosomal protein S28E

SCOP Domain Sequences for d1ne3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ne3a_ b.40.4.5 (A:) Ribosomal protein S28e {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
mddatpaevievlkrtgmtgevmqvkcrildgrdkgriltrnvmgpiregdilmlldtir
eakeirtp

SCOP Domain Coordinates for d1ne3a_:

Click to download the PDB-style file with coordinates for d1ne3a_.
(The format of our PDB-style files is described here.)

Timeline for d1ne3a_: