Class b: All beta proteins [48724] (165 folds) |
Fold b.40: OB-fold [50198] (12 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) |
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (22 proteins) barrel, closed; n=5, S=8 |
Protein Ribosomal protein S28e [101765] (2 species) incomplete OB-fold lacking the last strand |
Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [101767] (1 PDB entry) |
Domain d1ne3a_: 1ne3 A: [91828] structural genomics |
PDB Entry: 1ne3 (more details)
SCOP Domain Sequences for d1ne3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ne3a_ b.40.4.5 (A:) Ribosomal protein S28e {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} mddatpaevievlkrtgmtgevmqvkcrildgrdkgriltrnvmgpiregdilmlldtir eakeirtp
Timeline for d1ne3a_: